MedPro Business Advisors Monthly Hosting Agreement

Web, Domain & Email Hosting Monthly Package

We will:

• Host two domains (woodlandparkfamilyfamilymedicine.com and wpfamilymedicine.com) and two websites (woodlandparkfamilymedicine.com and vitality-aesthetics.com). Additional domains and websites will incur an additional fee.
• Renew the woodlandparkfamilymedicine.com and wpfamilymedicine.com domains on a yearly basis through our preferred domain registrar.
• Provide up to 25 regular and 25 forwarding emails (name@yourwebsite.com). Additional emails will incur an additional fee.
• Provide CPanel access to your hosting account for your webmaster and technical assistants.
• Assist in the one-time transfer of emails for woodlandparkfamilymedicine.com/wpfamilymedicine.com from one server to another and provide a tutorial for your technical assistant on setting up and deleting email addresses.
• Charge you $50/month for this service.

You will:

• Pay us $50.00 per month via credit/debit card on an automatically recurring basis, agreeing to the terms above.
• Appoint Marcum Group Media as your representative with full access to your hosting, domains, website and email technical records, including passwords and usernames, only as necessary.
• Agree to notify us with sixty days notice to cancel this agreement.